(data stored in ACNUC1104 zone)

EMBL: CP000509.PE401

CP000509.PE401       Location/Qualifiers
FT   CDS             complement(439817..442225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0408"
FT                   /product="Thrombospondin type 3 repeat"
FT                   /note="PFAM: Thrombospondin type 3 repeat; KEGG:
FT                   ade:Adeh_3645 outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79951"
FT                   /db_xref="GOA:A1SDR6"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR6"
FT                   /protein_id="ABL79951.1"
FT                   /translation="MDRKSSLVLLLLLALALVGMGAPAASSPSSEFVRPSWGDGQLPAG
FT                   CVVDRDPLNPDNLCYHMKVGLNALDSPKVDVDVLVPVSPAAERDMRVAEQAVMMWEGGL
FT                   HHLADQMDLPWLKDGFDMNVRTHQVVVDPTGALQQPLALVDPEIVVIVSNPAGGVGIGI
FT                   DPVSFAGELGIIDGEGAPCAAVPSPLDFGTWTDKPGFEQHGREKGGVYVEDCGGVGGNV
FT                   CFAVNGAVDPVPGASDFFGLFDLVAHEFGHCLTLGHVGDGADGPWGPTPTNDIMAYSTD
FT                   PPGVAKCVSTLDVEGFALRMSRYLDVNGDGAVDRHDHLAPNDVRGDGFNSFQVQHPDDH
FT                   LYASSTGDPADCPQPELGPVPLSYGSWSPKPVATTRPVLRTSSLQVTNGHVHVRGDATN
FT                   EPLGKTPTQRSARATDATSDSPTPVTDLTGVQVSVTRRTVDATMSVTQVWPVAQGGSAT
FT                   AYSLLVSGRRFDSFICTGDTSGTPQVMDNGTGYYLPGGSATWNYDDNTVTFHIRRDYLA
FT                   DQQIEAPYTVNAITGLHARGNDWIATTDAAPDGAGLRLAAPPMGAETRDAPVARTVRTA
FT                   RVELTPEGGASVLPTDSTLGVGLVSAVDSRDYFDLPIAKQATAEVTLSWTGSTIFGLSV
FT                   NGGSGQQVAEQDGRITVTVPWARRDLSITVDPQEVVEPTTYTLTARLTTVRADHDRDRV
FT                   PDVADRCPTRPGPSASSGCPDTDADGILDRDDRCPTEASASASGCPTDGDERVVLIVDG
FT                   RRLAAQTVVTAHGSAAFTLDGVVGRGTHRVVLAWIRDGKVVARISRRAG"
     MDRKSSLVLL LLLALALVGM GAPAASSPSS EFVRPSWGDG QLPAGCVVDR DPLNPDNLCY        60
     HMKVGLNALD SPKVDVDVLV PVSPAAERDM RVAEQAVMMW EGGLHHLADQ MDLPWLKDGF       120
     DMNVRTHQVV VDPTGALQQP LALVDPEIVV IVSNPAGGVG IGIDPVSFAG ELGIIDGEGA       180
     PCAAVPSPLD FGTWTDKPGF EQHGREKGGV YVEDCGGVGG NVCFAVNGAV DPVPGASDFF       240
     GLFDLVAHEF GHCLTLGHVG DGADGPWGPT PTNDIMAYST DPPGVAKCVS TLDVEGFALR       300
     MSRYLDVNGD GAVDRHDHLA PNDVRGDGFN SFQVQHPDDH LYASSTGDPA DCPQPELGPV       360
     PLSYGSWSPK PVATTRPVLR TSSLQVTNGH VHVRGDATNE PLGKTPTQRS ARATDATSDS       420
     PTPVTDLTGV QVSVTRRTVD ATMSVTQVWP VAQGGSATAY SLLVSGRRFD SFICTGDTSG       480
     TPQVMDNGTG YYLPGGSATW NYDDNTVTFH IRRDYLADQQ IEAPYTVNAI TGLHARGNDW       540
     IATTDAAPDG AGLRLAAPPM GAETRDAPVA RTVRTARVEL TPEGGASVLP TDSTLGVGLV       600
     SAVDSRDYFD LPIAKQATAE VTLSWTGSTI FGLSVNGGSG QQVAEQDGRI TVTVPWARRD       660
     LSITVDPQEV VEPTTYTLTA RLTTVRADHD RDRVPDVADR CPTRPGPSAS SGCPDTDADG       720
     ILDRDDRCPT EASASASGCP TDGDERVVLI VDGRRLAAQT VVTAHGSAAF TLDGVVGRGT       780
     HRVVLAWIRD GKVVARISRR AG                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page