(data stored in ACNUC1104 zone)

EMBL: CP000509.PE403

CP000509.PE403       Location/Qualifiers
FT   CDS             complement(443037..443549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_4078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79953"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR8"
FT                   /protein_id="ABL79953.1"
FT                   /translation="MKTPPPPAALATAAALAQRLLGGPRPARPARTAAAGLVGAASAGL
FT                   LVAAVEQFRRTGTTVNPLEPGTATDLVTTGANAVSRNPMYVGMAGVLVAHALLRGRWAA
FT                   LLPAAAFVVAIDRGQIAAEEAALRERFPGDYSTYAARVPRWVGLPGSRRTSDAGPHRRG
FT                   CRATVDS"
     MKTPPPPAAL ATAAALAQRL LGGPRPARPA RTAAAGLVGA ASAGLLVAAV EQFRRTGTTV        60
     NPLEPGTATD LVTTGANAVS RNPMYVGMAG VLVAHALLRG RWAALLPAAA FVVAIDRGQI       120
     AAEEAALRER FPGDYSTYAA RVPRWVGLPG SRRTSDAGPH RRGCRATVDS                  170
//

If you have problems or comments...

PBIL Back to PBIL home page