(data stored in ACNUC1104 zone)

EMBL: CP000509.PE404

CP000509.PE404       Location/Qualifiers
FT   CDS             complement(443569..444246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0411"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG: blo:BL0088
FT                   narrowly conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79954"
FT                   /db_xref="GOA:A1SDR9"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR9"
FT                   /protein_id="ABL79954.1"
FT                   /translation="MTHAPGTDKRSTGGLGTDEELAEGSRLHRLRHSRATVWVTMLVAS
FT                   VASLVASFVLSIDALRLAEDPNADLGCNINAVISCGTVANSWQSSLLGFPNAFLGLVTE
FT                   PVVITLAVASLAGIRFPRWFMLAAQAVYTVGLAFAYWLFYEAMFDIGALCPWCLLVTLA
FT                   TTLVFFEMTYVNIRDANLYLPRRVQAGLVAMVRSNLDLVLVVAWILVLVLAVVLKYGDA
FT                   LFA"
     MTHAPGTDKR STGGLGTDEE LAEGSRLHRL RHSRATVWVT MLVASVASLV ASFVLSIDAL        60
     RLAEDPNADL GCNINAVISC GTVANSWQSS LLGFPNAFLG LVTEPVVITL AVASLAGIRF       120
     PRWFMLAAQA VYTVGLAFAY WLFYEAMFDI GALCPWCLLV TLATTLVFFE MTYVNIRDAN       180
     LYLPRRVQAG LVAMVRSNLD LVLVVAWILV LVLAVVLKYG DALFA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page