(data stored in ACNUC1104 zone)

EMBL: CP000509.PE405

CP000509.PE405       Location/Qualifiers
FT   CDS             complement(444243..445073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0412"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: nfa:nfa52230
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79955"
FT                   /db_xref="GOA:A1SDS0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS0"
FT                   /protein_id="ABL79955.1"
FT                   /translation="MSTAGHDHRPGLPKNDHRKSRMSKQGRIRTQQMREQQRIVEEQQA
FT                   RRRRLVTAVGAVVILGLVAAIVFAVVRTVTGDDDSAPAASGPLVAPANIEPSGSFAVGQ
FT                   DDAPVTVEIYYDYMCPACGAFEAANSGELDRLVADGTARIELRPISFLDEQSRGTRYST
FT                   RAANAFATVVHGAPDRAWAFHSALYENQPAEGTEGLSNDQIAAIARDAGVPDDVVEQFG
FT                   EGTYEPWTASVTQKAFDSGIQGTPTVVIDGEQFQGDVYTVGPLTEAIESAAGSQ"
     MSTAGHDHRP GLPKNDHRKS RMSKQGRIRT QQMREQQRIV EEQQARRRRL VTAVGAVVIL        60
     GLVAAIVFAV VRTVTGDDDS APAASGPLVA PANIEPSGSF AVGQDDAPVT VEIYYDYMCP       120
     ACGAFEAANS GELDRLVADG TARIELRPIS FLDEQSRGTR YSTRAANAFA TVVHGAPDRA       180
     WAFHSALYEN QPAEGTEGLS NDQIAAIARD AGVPDDVVEQ FGEGTYEPWT ASVTQKAFDS       240
     GIQGTPTVVI DGEQFQGDVY TVGPLTEAIE SAAGSQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page