(data stored in ACNUC1104 zone)

EMBL: CP000509.PE407

CP000509.PE407       Location/Qualifiers
FT   CDS             445679..447970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0414"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   C-terminal domain protein; KEGG: nfa:nfa43000 putative
FT                   esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79957"
FT                   /db_xref="GOA:A1SDS2"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS2"
FT                   /protein_id="ABL79957.1"
FT                   /translation="MCFLCWSCGCAGSGVRASGRTLRWQHHAMRRARRAATASLVLAAV
FT                   LAGARLGTTGASAAGPGDPAGFTLRPSVNQLYVLSATPGEQLELVGADGATVAAGTVDA
FT                   AGSLAWRELAAGGYAVRPAADPGAQSDPVTVGDFDDPAPPQSFYDAQTLAPGFGYVTTR
FT                   DGTTLSANVVLPPGPGPFPTVVEYSGYDPSNPANTTMAQLFNTLGYAYVGVNMRGTGCS
FT                   GGSFLHFEPIQSLDGYDVIEAVAAQPWAKFHRVGMVGISYPGISQLYVARTRPPHLSAI
FT                   TPLSVIDDTYRGTLYPGGILNTGFAVPWATERASQAAPYGQGWERPRVDAGDSVCEANQ
FT                   ALRLQNPDPLQLIEDNPYYSAKVGDPISPSLFVHRIDVPVFIAGAWQDEQTGGHFPALL
FT                   DDFASAPHVYASMANGSHTESLSLGVFGRYADFLDLYVARRVPTAAKTFVAPILAQSLT
FT                   GVAGLSLPPGPDYTGLTYRQALRSYQSADPVRILFEEGAAAGQPSGAPLPRFVRTFPSW
FT                   PIPSAAPTAWYLTSTGRLRATPSSTRPAAATPRSYRADPTALPETTYSGSSSGIWAAHP
FT                   DYDWRQIPDGTGLGWLSAPLRTDVVAIGTGSVDLWVRTPALDTDLEVTLSEVRPNGREV
FT                   YVQSGWLRASHRALDTARSTPVSPVHTDLEADVRPLPAGRYTKLRIELFPFAQAFRAGS
FT                   RLRLTVDAPGGARPLWAFDTIADGERVSVAADAVRRSRLVLSVVPGVRVPATAPACASL
FT                   RSQPCRSFPG"
     MCFLCWSCGC AGSGVRASGR TLRWQHHAMR RARRAATASL VLAAVLAGAR LGTTGASAAG        60
     PGDPAGFTLR PSVNQLYVLS ATPGEQLELV GADGATVAAG TVDAAGSLAW RELAAGGYAV       120
     RPAADPGAQS DPVTVGDFDD PAPPQSFYDA QTLAPGFGYV TTRDGTTLSA NVVLPPGPGP       180
     FPTVVEYSGY DPSNPANTTM AQLFNTLGYA YVGVNMRGTG CSGGSFLHFE PIQSLDGYDV       240
     IEAVAAQPWA KFHRVGMVGI SYPGISQLYV ARTRPPHLSA ITPLSVIDDT YRGTLYPGGI       300
     LNTGFAVPWA TERASQAAPY GQGWERPRVD AGDSVCEANQ ALRLQNPDPL QLIEDNPYYS       360
     AKVGDPISPS LFVHRIDVPV FIAGAWQDEQ TGGHFPALLD DFASAPHVYA SMANGSHTES       420
     LSLGVFGRYA DFLDLYVARR VPTAAKTFVA PILAQSLTGV AGLSLPPGPD YTGLTYRQAL       480
     RSYQSADPVR ILFEEGAAAG QPSGAPLPRF VRTFPSWPIP SAAPTAWYLT STGRLRATPS       540
     STRPAAATPR SYRADPTALP ETTYSGSSSG IWAAHPDYDW RQIPDGTGLG WLSAPLRTDV       600
     VAIGTGSVDL WVRTPALDTD LEVTLSEVRP NGREVYVQSG WLRASHRALD TARSTPVSPV       660
     HTDLEADVRP LPAGRYTKLR IELFPFAQAF RAGSRLRLTV DAPGGARPLW AFDTIADGER       720
     VSVAADAVRR SRLVLSVVPG VRVPATAPAC ASLRSQPCRS FPG                         763
//

If you have problems or comments...

PBIL Back to PBIL home page