(data stored in SCRATCH zone)

EMBL: CP000509.PE408

CP000509.PE408       Location/Qualifiers
FT   CDS             448056..448667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0415"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   eca:ECA3669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79958"
FT                   /db_xref="GOA:A1SDS3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS3"
FT                   /protein_id="ABL79958.1"
FT                   /translation="MSSVLVPPPHTRLEDLLSLVTGVYVVSLGLSFLQASGAVTGGTAG
FT                   LALLLSYATPIGFGVLFVLINLPAFAVAAWKKGWPFTVKSLACVVGVSFATRLQAEVLD
FT                   LPDLDKLYGVVAGNLLAGVGLLILFRHGASLGGFNIIALLMQEKLGLRAGYVQMVLDVM
FT                   VVLGSAFVVDPGIVVLSALGAVVLNIVLAFNHRPGRYMGL"
     MSSVLVPPPH TRLEDLLSLV TGVYVVSLGL SFLQASGAVT GGTAGLALLL SYATPIGFGV        60
     LFVLINLPAF AVAAWKKGWP FTVKSLACVV GVSFATRLQA EVLDLPDLDK LYGVVAGNLL       120
     AGVGLLILFR HGASLGGFNI IALLMQEKLG LRAGYVQMVL DVMVVLGSAF VVDPGIVVLS       180
     ALGAVVLNIV LAFNHRPGRY MGL                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page