(data stored in ACNUC1104 zone)

EMBL: CP000509.PE409

CP000509.PE409       Location/Qualifiers
FT   CDS             complement(449692..450126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV6755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS4"
FT                   /protein_id="ABL79959.1"
FT                   /translation="MGTEPLPTDLLGTWTLTRVVDDHLTGERRDVVGVTTLAVESPDRV
FT                   RWSEEGTMTWAGRSVPVSRTLYVERAGETWEVTFSDGRPFHPWSVGHRVGHPCGADHYD
FT                   GLIEVGPEGWSVEWRATGPEKDYVMTTVHSDRRAARRSSD"
     MGTEPLPTDL LGTWTLTRVV DDHLTGERRD VVGVTTLAVE SPDRVRWSEE GTMTWAGRSV        60
     PVSRTLYVER AGETWEVTFS DGRPFHPWSV GHRVGHPCGA DHYDGLIEVG PEGWSVEWRA       120
     TGPEKDYVMT TVHSDRRAAR RSSD                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page