(data stored in ACNUC1104 zone)

EMBL: CP000509.PE413

CP000509.PE413       Location/Qualifiers
FT   CDS             452287..453144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0421"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: lxx:Lxx16700
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79963"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS8"
FT                   /protein_id="ABL79963.1"
FT                   /translation="MSIVITGATGHLGRLVVEALLARGAEGIVATGRSVERLADLADRG
FT                   VRVERLDFDDVPESVDWLGAGDVLLLVSGSEVGQRLPQHRAVVDLAVRAGVRRIAYTSA
FT                   PAADDTTLAVAPEHAATEAMIRESGLPFTFLRNGWYTENYLPTFAQARESGLVIGSAGE
FT                   GRVASAPRSDFAEAAAVVLTTDGHEGAVYELFGDAAWTYGELAATFADVLGREVTYRSL
FT                   TPEAHREALLAAGLDEGTAGFVVALDQDIAAGLLGLSTGHLAKLLGRPTVPLRDTVSTW
FT                   AAQD"
     MSIVITGATG HLGRLVVEAL LARGAEGIVA TGRSVERLAD LADRGVRVER LDFDDVPESV        60
     DWLGAGDVLL LVSGSEVGQR LPQHRAVVDL AVRAGVRRIA YTSAPAADDT TLAVAPEHAA       120
     TEAMIRESGL PFTFLRNGWY TENYLPTFAQ ARESGLVIGS AGEGRVASAP RSDFAEAAAV       180
     VLTTDGHEGA VYELFGDAAW TYGELAATFA DVLGREVTYR SLTPEAHREA LLAAGLDEGT       240
     AGFVVALDQD IAAGLLGLST GHLAKLLGRP TVPLRDTVST WAAQD                       285
//

If you have problems or comments...

PBIL Back to PBIL home page