(data stored in ACNUC1104 zone)

EMBL: CP000509.PE415

CP000509.PE415       Location/Qualifiers
FT   CDS             454035..454358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0423"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="KEGG: fal:FRAAL1608 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79965"
FT                   /db_xref="GOA:A1SDT0"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT0"
FT                   /protein_id="ABL79965.1"
FT                   /translation="MVGYAALVAVLAVVAARRGERPGWLDQMAWMLEVLLLVRALAGLG
FT                   PLLGDDRPDSTSTYVGYLFASVCVLPIAMRSVAGDRAAWSSAVVAVAAVAVGVVAVRLQ
FT                   MTA"
     MVGYAALVAV LAVVAARRGE RPGWLDQMAW MLEVLLLVRA LAGLGPLLGD DRPDSTSTYV        60
     GYLFASVCVL PIAMRSVAGD RAAWSSAVVA VAAVAVGVVA VRLQMTA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page