(data stored in SCRATCH zone)

EMBL: CP000509.PE420

CP000509.PE420       Location/Qualifiers
FT   CDS             458144..459244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0428"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rha:RHA1_ro04761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79970"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT5"
FT                   /protein_id="ABL79970.1"
FT                   /translation="MTPSTSPASTPTAFAVSPDSGEHWSKAGAWQVADGIHRIPLPLPM
FT                   DGLKAINVYVIESADGLTLIDGGWAIDVARDLLERCLRQVGYGFGDIRRFLVTHVHRDH
FT                   FTLATVLGHEYGADVALGLGEKPALDLLNDRLLDESPFLDVLRTAGANAIADLWAAGGE
FT                   RPDPAMWLLPDTWLEGDHEIEVGVRTLDAVHTPGHTPGHYVFAEQAAGLLFAGDHVLPT
FT                   ITPSIGFTVPPTPDPLGDFMASLTKVRALPDLKVLPAHGPVAPSSHARADELLSFHDRR
FT                   LEQSLAAIAEEPGTGFTVAHQLAWTRHEKAYDELDLFSQGMAAMEIKAHLELLVARGQA
FT                   TRADTPEGVLFSAVPAGAPGEDTLSG"
     MTPSTSPAST PTAFAVSPDS GEHWSKAGAW QVADGIHRIP LPLPMDGLKA INVYVIESAD        60
     GLTLIDGGWA IDVARDLLER CLRQVGYGFG DIRRFLVTHV HRDHFTLATV LGHEYGADVA       120
     LGLGEKPALD LLNDRLLDES PFLDVLRTAG ANAIADLWAA GGERPDPAMW LLPDTWLEGD       180
     HEIEVGVRTL DAVHTPGHTP GHYVFAEQAA GLLFAGDHVL PTITPSIGFT VPPTPDPLGD       240
     FMASLTKVRA LPDLKVLPAH GPVAPSSHAR ADELLSFHDR RLEQSLAAIA EEPGTGFTVA       300
     HQLAWTRHEK AYDELDLFSQ GMAAMEIKAH LELLVARGQA TRADTPEGVL FSAVPAGAPG       360
     EDTLSG                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page