(data stored in ACNUC1104 zone)

EMBL: CP000509.PE422

CP000509.PE422       Location/Qualifiers
FT   CDS             complement(459674..460591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0430"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: eli:ELI_09720 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79972"
FT                   /db_xref="GOA:A1SDT7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT7"
FT                   /protein_id="ABL79972.1"
FT                   /translation="MSPSRRHEALAWVVPRLRRSRDLGTPEAERARIERWHARLARRLP
FT                   TRVTPGFAKRFSVVTEVLTGRSGEFASYVVTPRGTDPRRTVVYLHGGGYVAPIDPFHVR
FT                   YLCRLATDLHARIVLPDYPLAPEHTWRDSHAAIADLTGRWVGDSDQLVLAGDSAGGGYA
FT                   LAIAQTLRDRGGPQPARLLLHSPWVDLTTATPETESFTVRDPWLFLGKLQAYAAWWAGS
FT                   TEDLGRPEVSPALAELGGLPPALMFCGTRDTLTPGCRLLARRAEQADWDLTYVEVHDLI
FT                   HVYPLLPFIPEAREARRRTMEFLR"
     MSPSRRHEAL AWVVPRLRRS RDLGTPEAER ARIERWHARL ARRLPTRVTP GFAKRFSVVT        60
     EVLTGRSGEF ASYVVTPRGT DPRRTVVYLH GGGYVAPIDP FHVRYLCRLA TDLHARIVLP       120
     DYPLAPEHTW RDSHAAIADL TGRWVGDSDQ LVLAGDSAGG GYALAIAQTL RDRGGPQPAR       180
     LLLHSPWVDL TTATPETESF TVRDPWLFLG KLQAYAAWWA GSTEDLGRPE VSPALAELGG       240
     LPPALMFCGT RDTLTPGCRL LARRAEQADW DLTYVEVHDL IHVYPLLPFI PEAREARRRT       300
     MEFLR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page