(data stored in ACNUC1104 zone)

EMBL: CP000509.PE423

CP000509.PE423       Location/Qualifiers
FT   CDS             460688..461275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0431"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sma:SAV1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79973"
FT                   /db_xref="GOA:A1SDT8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT8"
FT                   /protein_id="ABL79973.1"
FT                   /translation="MPSTFRIPKATITGLYGKVVSAYARRTFGEIPDGLYVYFHHKPLM
FT                   RAVVGFEGKVAKWGALDPTLKSYAELASAGTIGCSWCLDFGYFKAHDEGVDLAKVSEVP
FT                   RWRESDVFTPLEREVLEYAEAMTATPPTVTDAMVARLVEQLGTPAVVELTQIVALENMR
FT                   SRFNSAAGLQSQGYSDVCELPLAVPSGDVRPA"
     MPSTFRIPKA TITGLYGKVV SAYARRTFGE IPDGLYVYFH HKPLMRAVVG FEGKVAKWGA        60
     LDPTLKSYAE LASAGTIGCS WCLDFGYFKA HDEGVDLAKV SEVPRWRESD VFTPLEREVL       120
     EYAEAMTATP PTVTDAMVAR LVEQLGTPAV VELTQIVALE NMRSRFNSAA GLQSQGYSDV       180
     CELPLAVPSG DVRPA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page