(data stored in ACNUC1104 zone)

EMBL: CP000509.PE424

CP000509.PE424       Location/Qualifiers
FT   CDS             461272..462150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0432"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: DNA gyrase C-terminal repeat, beta-propeller;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; Sigma-70, region 4 type 2; KEGG: sco:SCO2742
FT                   putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79974"
FT                   /db_xref="GOA:A1SDT9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT9"
FT                   /protein_id="ABL79974.1"
FT                   /translation="MNATDSTDVFVDHRNLLFTVAYEMLGSAADAEDVLQETWLRWVEV
FT                   DREEVREARAYLVRIATRLALNRMRTNARRRESYVGPWLPEPLLTTPDVAEDVELADSV
FT                   SLAMLTLLETLGPTERAVFVLREVFDFGYDEIAAAVDKTPAAVRQIAHRARGHVAERRP
FT                   RAEATRSEREHVMATFLAAVATGDIQSLMDVLAPDVVLVTDGGGVKKAALRPILGRDKV
FT                   VRFLGAVSEGLDAVADVVVVNGAPALRIVLDGELDTVASMVVEDGLVTGLYVVRNPAKL
FT                   ARLDAVVTLTR"
     MNATDSTDVF VDHRNLLFTV AYEMLGSAAD AEDVLQETWL RWVEVDREEV REARAYLVRI        60
     ATRLALNRMR TNARRRESYV GPWLPEPLLT TPDVAEDVEL ADSVSLAMLT LLETLGPTER       120
     AVFVLREVFD FGYDEIAAAV DKTPAAVRQI AHRARGHVAE RRPRAEATRS EREHVMATFL       180
     AAVATGDIQS LMDVLAPDVV LVTDGGGVKK AALRPILGRD KVVRFLGAVS EGLDAVADVV       240
     VVNGAPALRI VLDGELDTVA SMVVEDGLVT GLYVVRNPAK LARLDAVVTL TR               292
//

If you have problems or comments...

PBIL Back to PBIL home page