(data stored in ACNUC1104 zone)

EMBL: CP000509.PE43

CP000509.PE43        Location/Qualifiers
FT   CDS             49062..49934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0043"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tte:TTE1936 sugar
FT                   permeases; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79593"
FT                   /db_xref="GOA:A1SCQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ8"
FT                   /protein_id="ABL79593.1"
FT                   /translation="MSTRRPARPVRETPRTWLSKAVTYVLLTLGAVVILGPFLWMVRSV
FT                   ITPNSVLYSRGGGGVIPRHFTLDHITGAFTEGIQPFDVYFVNSLIVTAIAVVSNVFFCG
FT                   LAGFALARFEFVGRRALLIVIVLMLAIPIESRIIPLYILASRSGFSNTYFGIALPLLVT
FT                   SLGIFLMRQYVMTIPREIDEAATVDGCSAWRLYWQIIFPICRPVIAAIAIFTFITAWND
FT                   FLWPLVITQTQDMQTLPVAAANLAVVKDQLRWGTLLAFSLLSVLPVLIFYLFMQRQFMA
FT                   GITGGAVKE"
     MSTRRPARPV RETPRTWLSK AVTYVLLTLG AVVILGPFLW MVRSVITPNS VLYSRGGGGV        60
     IPRHFTLDHI TGAFTEGIQP FDVYFVNSLI VTAIAVVSNV FFCGLAGFAL ARFEFVGRRA       120
     LLIVIVLMLA IPIESRIIPL YILASRSGFS NTYFGIALPL LVTSLGIFLM RQYVMTIPRE       180
     IDEAATVDGC SAWRLYWQII FPICRPVIAA IAIFTFITAW NDFLWPLVIT QTQDMQTLPV       240
     AAANLAVVKD QLRWGTLLAF SLLSVLPVLI FYLFMQRQFM AGITGGAVKE                  290
//

If you have problems or comments...

PBIL Back to PBIL home page