(data stored in ACNUC1104 zone)

EMBL: CP000509.PE432

CP000509.PE432       Location/Qualifiers
FT   CDS             471452..472498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79982"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU7"
FT                   /protein_id="ABL79982.1"
FT                   /translation="MSKHSGPELVDWDLAVALGSRIAGDGPVVDRRTADAVVAELRADA
FT                   DRSTGLVRAHTGLLAAERTAPVLVVDRPGWVIANADGFATILAPVVDKLSSRKGEPTGL
FT                   TKAIGSRVTGAEVGALLGFLAGKVLGQFDPFHAPSGRLLLVAPNIVHVERELGVVPRDF
FT                   RLWVCLHEETHRVQFTATPWLADHLLGEMHALAESLEPSGLLDDGLTRIAGAVRSAREG
FT                   GGSLLDLIGTPEQKEIVDRVTGVMSLLEGHADVVMDDVGPGVIPTVADIRKRFNRRRQG
FT                   VGVLDRLLRRVLGLDAKMAQYRDGAKFVRAVVDKAGMTEFNAVWERPENLPSKAEIADP
FT                   RAWISRVL"
     MSKHSGPELV DWDLAVALGS RIAGDGPVVD RRTADAVVAE LRADADRSTG LVRAHTGLLA        60
     AERTAPVLVV DRPGWVIANA DGFATILAPV VDKLSSRKGE PTGLTKAIGS RVTGAEVGAL       120
     LGFLAGKVLG QFDPFHAPSG RLLLVAPNIV HVERELGVVP RDFRLWVCLH EETHRVQFTA       180
     TPWLADHLLG EMHALAESLE PSGLLDDGLT RIAGAVRSAR EGGGSLLDLI GTPEQKEIVD       240
     RVTGVMSLLE GHADVVMDDV GPGVIPTVAD IRKRFNRRRQ GVGVLDRLLR RVLGLDAKMA       300
     QYRDGAKFVR AVVDKAGMTE FNAVWERPEN LPSKAEIADP RAWISRVL                    348
//

If you have problems or comments...

PBIL Back to PBIL home page