(data stored in SCRATCH zone)

EMBL: CP000509.PE433

CP000509.PE433       Location/Qualifiers
FT   CDS             472519..473484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0441"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: tfu:Tfu_2897
FT                   helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79983"
FT                   /db_xref="GOA:A1SDU8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU8"
FT                   /protein_id="ABL79983.1"
FT                   /translation="MSLHPAIAAVRLAVRRALAHVDPGRTVVVACSGGADSLALLAATV
FT                   FEGRRAGWRVVGATVDHGLQPGSADHAAHVVRQMAALGADETVAATVHVEAAGQGPEAA
FT                   ARQARYAVLDQLAERFDADAVLLGHTRDDQAETVLLGLARGSGGRSLAGMRRSFDRFVR
FT                   PLLDLSRADTATACQVAGIEFWSDPHNEDPAFTRVRVRRSVLPVLEDQLGPGVAEALAR
FT                   TADQLRADMDLLDDAAEAAYQRLRDLPVDGLLAEPGPIRRRVLRLAALAAGAPASELFH
FT                   EHVLAMDALLTHWHGQKWVDLPGKVRCRRADGRLRLGPAG"
     MSLHPAIAAV RLAVRRALAH VDPGRTVVVA CSGGADSLAL LAATVFEGRR AGWRVVGATV        60
     DHGLQPGSAD HAAHVVRQMA ALGADETVAA TVHVEAAGQG PEAAARQARY AVLDQLAERF       120
     DADAVLLGHT RDDQAETVLL GLARGSGGRS LAGMRRSFDR FVRPLLDLSR ADTATACQVA       180
     GIEFWSDPHN EDPAFTRVRV RRSVLPVLED QLGPGVAEAL ARTADQLRAD MDLLDDAAEA       240
     AYQRLRDLPV DGLLAEPGPI RRRVLRLAAL AAGAPASELF HEHVLAMDAL LTHWHGQKWV       300
     DLPGKVRCRR ADGRLRLGPA G                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page