(data stored in ACNUC1104 zone)

EMBL: CP000509.PE434

CP000509.PE434       Location/Qualifiers
FT   CDS             473580..474293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79984"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU9"
FT                   /protein_id="ABL79984.1"
FT                   /translation="MSHRRTFAAAVALLAAAVIAPQALPASASPAGRAVTAQRAGQALI
FT                   QGVVVDQAGRYVDDVEVQATKADGTPAASAITYASDREDGPQHGYFFLEVTRGTYTLTF
FT                   SRDGYRTLVLDDLQIERARQKLSLGEVEIQKKLAESKTEASLVRRTITTKQNGEVVVTV
FT                   SARGVKPTGDVEIREGRTVVGEDGLRARDNGQVTIELDRLPRGTHELKAYYLGSPDLKV
FT                   SASTSFTLTVTRGRH"
     MSHRRTFAAA VALLAAAVIA PQALPASASP AGRAVTAQRA GQALIQGVVV DQAGRYVDDV        60
     EVQATKADGT PAASAITYAS DREDGPQHGY FFLEVTRGTY TLTFSRDGYR TLVLDDLQIE       120
     RARQKLSLGE VEIQKKLAES KTEASLVRRT ITTKQNGEVV VTVSARGVKP TGDVEIREGR       180
     TVVGEDGLRA RDNGQVTIEL DRLPRGTHEL KAYYLGSPDL KVSASTSFTL TVTRGRH          237
//

If you have problems or comments...

PBIL Back to PBIL home page