(data stored in ACNUC1104 zone)

EMBL: CP000509.PE441

CP000509.PE441       Location/Qualifiers
FT   CDS             479743..480234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3402 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79991"
FT                   /db_xref="GOA:A1SDV6"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV6"
FT                   /protein_id="ABL79991.1"
FT                   /translation="MSAGPSGEEPQPTGRLRPTSGGALTAWAVAGLVGGWLLHPAAERV
FT                   RDTAPIVTWAQPLALVLVAAILGATAYLTWRTVHVQQQRLEPQRAVNRLVLARSCALVG
FT                   ALVAGGYLGYAVSWIGVDTELATQRAWRSAVAAAAGVGIVVTSVLLERACRVRSDDEDT
FT                   "
     MSAGPSGEEP QPTGRLRPTS GGALTAWAVA GLVGGWLLHP AAERVRDTAP IVTWAQPLAL        60
     VLVAAILGAT AYLTWRTVHV QQQRLEPQRA VNRLVLARSC ALVGALVAGG YLGYAVSWIG       120
     VDTELATQRA WRSAVAAAAG VGIVVTSVLL ERACRVRSDD EDT                         163
//

If you have problems or comments...

PBIL Back to PBIL home page