(data stored in ACNUC1104 zone)

EMBL: CP000509.PE444

CP000509.PE444       Location/Qualifiers
FT   CDS             complement(482221..483255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0452"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV7409 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79994"
FT                   /db_xref="GOA:A1SDV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV9"
FT                   /protein_id="ABL79994.1"
FT                   /translation="MDATGSAAAGPTSTEPMIRLSGVGKTYDDGTVAVHALDLEVERGE
FT                   LVCLVGPSGCGKSTTLKMINRLIEPTTGTIEIDGRDVTGQDPVRLRRGIGYVIQEVGLF
FT                   PHQKIIANVMTVPLLYGESRATARERARELLELVGLDPATYAERYPTQLSGGQQQRVGV
FT                   ARALAAKPPVLLMDEPFGAVDPLVRLRLQDEFLRLQRELGVTVVFVTHDIDEAVRLGDR
FT                   VAVFATGGRLAQYDTPARLLGRPADDFVAEFVGSTSGLRRLDVTPLDPAHLEPMDGVTA
FT                   GDLGAAIDVDSTLGHALAVLLRGDAGMVGVREGARFVGVLTPNGIHRALRAALAEMAEV
FT                   ASAG"
     MDATGSAAAG PTSTEPMIRL SGVGKTYDDG TVAVHALDLE VERGELVCLV GPSGCGKSTT        60
     LKMINRLIEP TTGTIEIDGR DVTGQDPVRL RRGIGYVIQE VGLFPHQKII ANVMTVPLLY       120
     GESRATARER ARELLELVGL DPATYAERYP TQLSGGQQQR VGVARALAAK PPVLLMDEPF       180
     GAVDPLVRLR LQDEFLRLQR ELGVTVVFVT HDIDEAVRLG DRVAVFATGG RLAQYDTPAR       240
     LLGRPADDFV AEFVGSTSGL RRLDVTPLDP AHLEPMDGVT AGDLGAAIDV DSTLGHALAV       300
     LLRGDAGMVG VREGARFVGV LTPNGIHRAL RAALAEMAEV ASAG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page