(data stored in ACNUC1104 zone)

EMBL: CP000509.PE450

CP000509.PE450       Location/Qualifiers
FT   CDS             487979..488893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80000"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW5"
FT                   /protein_id="ABL80000.1"
FT                   /translation="MTAHLGATGLANLEGHTDFDITWPWLRPGGLRPGSTAVLRVKNEA
FT                   PSLPFVLPPLLRACEFVLLVDNGSDDGTPDVARETAERAGRADRLTVTSYPFAVARAGA
FT                   EHLAQHELSVHSLAYFYNWCFSQVTTRYSWKWDGDMVLTTEGEVSIADLGWQVGDVQSI
FT                   IRVPRHGLYLESEAKGYLDLGWRNAEEWGFPIGPDFVYTKAFEWEIRTTPVGVRSIGLP
FT                   HGLCVELKYLDGEEFAHWTDPESFATSWRNRRKRREWEVFHALKEGRVPPGVHEITAPA
FT                   GVHIVDHVTHDWLPHAPRPLQVG"
     MTAHLGATGL ANLEGHTDFD ITWPWLRPGG LRPGSTAVLR VKNEAPSLPF VLPPLLRACE        60
     FVLLVDNGSD DGTPDVARET AERAGRADRL TVTSYPFAVA RAGAEHLAQH ELSVHSLAYF       120
     YNWCFSQVTT RYSWKWDGDM VLTTEGEVSI ADLGWQVGDV QSIIRVPRHG LYLESEAKGY       180
     LDLGWRNAEE WGFPIGPDFV YTKAFEWEIR TTPVGVRSIG LPHGLCVELK YLDGEEFAHW       240
     TDPESFATSW RNRRKRREWE VFHALKEGRV PPGVHEITAP AGVHIVDHVT HDWLPHAPRP       300
     LQVG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page