(data stored in SCRATCH zone)

EMBL: CP000509.PE458

CP000509.PE458       Location/Qualifiers
FT   CDS             495691..498276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0466"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
FT                   protein; Clp N terminal domain protein; ATPase associated
FT                   with various cellular activities, AAA_5; ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase; KEGG: sma:SAV4697
FT                   putative ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80008"
FT                   /db_xref="GOA:A1SDX3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX3"
FT                   /protein_id="ABL80008.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLSHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLDISLEAVRAQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHSYIG
FT                   TEHILLGLIREGEGVAAQVLQKLGADLNRVRQQVIQLLSGFQGKESAGSAAATGASGGD
FT                   APSSSLVLDQFGRNLTQDAREGKLDPVIGREQEIERVMQILSRRTKNNPVLIGEPGVGK
FT                   TTIVEGLAQDIVKGNVPETLKDKQIYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGD
FT                   IVLFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYLEKDAALER
FT                   RFQPIQVAEPSIAHTIEMLKGLRDRYEAHHRVTITDEALVSAATLADRYISDRFLPDKA
FT                   IDLIDEAGSRLRIRRMTAPADLREYDDKIGEVRQRKEAAIDGQDFEAAARLRDEEKQLI
FT                   LKKSEREKQWRAGDMDEVAEVDEELIAEVLAVATGIPIVKLSEEESTRLLKMEDELHKR
FT                   VIGQEEAVKALSRAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTWLSKTLAEFLFGDEDA
FT                   LIQLDMSEFGEKHTVSRLFGSPPGYVGYEEGGQLTEKVRRKPFSVVLFDEVEKAHPDIF
FT                   NSLLQILEEGRLTDSQGRVVDFKNTVIIMTTNLGTRDIAKGINLGFQQSGDAAGSYERM
FT                   KSKVSEELKQHFRPEFLNRVDEVIVFPPLSQEQIVHMVDNMIASVELRMKDRDMRIELT
FT                   QNAKNLLAERGFDPVLGARPLRRTIQREIEDVLAEKMLYGEVGPGQIVLVDVEGEGPTA
FT                   TFTFSGQKVGDLPDLPPFETAEVTSSEATPPTEGPDDSDSGTDVPKSTD"
     MFERFTDRAR RVVVLAQEEA RMLSHNYIGT EHILLGLIHE GEGVAAKALE SLDISLEAVR        60
     AQVEEIIGQG QQAPSGHIPF TPRAKKVLEL SLREALQLGH SYIGTEHILL GLIREGEGVA       120
     AQVLQKLGAD LNRVRQQVIQ LLSGFQGKES AGSAAATGAS GGDAPSSSLV LDQFGRNLTQ       180
     DAREGKLDPV IGREQEIERV MQILSRRTKN NPVLIGEPGV GKTTIVEGLA QDIVKGNVPE       240
     TLKDKQIYTL DLGALVAGSR YRGDFEERLK KVLKEIRTRG DIVLFIDEIH TLVGAGAAEG       300
     AIDAASILKP MLARGELQTI GATTLDEYRK YLEKDAALER RFQPIQVAEP SIAHTIEMLK       360
     GLRDRYEAHH RVTITDEALV SAATLADRYI SDRFLPDKAI DLIDEAGSRL RIRRMTAPAD       420
     LREYDDKIGE VRQRKEAAID GQDFEAAARL RDEEKQLILK KSEREKQWRA GDMDEVAEVD       480
     EELIAEVLAV ATGIPIVKLS EEESTRLLKM EDELHKRVIG QEEAVKALSR AIRRTRAGLK       540
     DPKRPGGSFI FAGPSGVGKT WLSKTLAEFL FGDEDALIQL DMSEFGEKHT VSRLFGSPPG       600
     YVGYEEGGQL TEKVRRKPFS VVLFDEVEKA HPDIFNSLLQ ILEEGRLTDS QGRVVDFKNT       660
     VIIMTTNLGT RDIAKGINLG FQQSGDAAGS YERMKSKVSE ELKQHFRPEF LNRVDEVIVF       720
     PPLSQEQIVH MVDNMIASVE LRMKDRDMRI ELTQNAKNLL AERGFDPVLG ARPLRRTIQR       780
     EIEDVLAEKM LYGEVGPGQI VLVDVEGEGP TATFTFSGQK VGDLPDLPPF ETAEVTSSEA       840
     TPPTEGPDDS DSGTDVPKST D                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page