(data stored in ACNUC1104 zone)

EMBL: CP000509.PE46

CP000509.PE46        Location/Qualifiers
FT   CDS             complement(51689..52852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0046"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   ppu:PP_3725 acyl-CoA dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79596"
FT                   /db_xref="GOA:A1SCR1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR1"
FT                   /protein_id="ABL79596.1"
FT                   /translation="MTLAPDELEEMAATTRRFIRERIHPIEQEVDDTDHIDPQVWQSLV
FT                   DESVELGLYTANVPETLGGPGLTIAEQTRLWEEFGHTSWPFSYLLARPHRVLFACTEEQ
FT                   RSRYLDPVLAGKRAQCFALTEPGAGSDNSAMRTRAEKVEGGYVLNGAKHFISHGNADFA
FT                   IVFAVTGPPLRGRTPQVTAFLVDRGTPGFTVGKAQRMMGWSGMEECELVFENCFVPDDQ
FT                   VLGTPGEALRLGLASVAQRRLQMAAYCVGAMERLLGLSIAYTRDRVVFDEPLFDKQGIR
FT                   WMLAEAAMEPYLAREATYKAARLCDEARAAGRSEIELSRLFAREISIAKLHATRALNRV
FT                   ADVAVQVHGGMGWCREYPVERLYRDARVFRIIEGADEVHKEIIAKAL"
     MTLAPDELEE MAATTRRFIR ERIHPIEQEV DDTDHIDPQV WQSLVDESVE LGLYTANVPE        60
     TLGGPGLTIA EQTRLWEEFG HTSWPFSYLL ARPHRVLFAC TEEQRSRYLD PVLAGKRAQC       120
     FALTEPGAGS DNSAMRTRAE KVEGGYVLNG AKHFISHGNA DFAIVFAVTG PPLRGRTPQV       180
     TAFLVDRGTP GFTVGKAQRM MGWSGMEECE LVFENCFVPD DQVLGTPGEA LRLGLASVAQ       240
     RRLQMAAYCV GAMERLLGLS IAYTRDRVVF DEPLFDKQGI RWMLAEAAME PYLAREATYK       300
     AARLCDEARA AGRSEIELSR LFAREISIAK LHATRALNRV ADVAVQVHGG MGWCREYPVE       360
     RLYRDARVFR IIEGADEVHK EIIAKAL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page