(data stored in ACNUC1104 zone)

EMBL: CP000509.PE461

CP000509.PE461       Location/Qualifiers
FT   CDS             complement(500207..501289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0469"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: fal:FRAAL6529 nucleic-acid-binding
FT                   protein protein, containing HHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80011"
FT                   /db_xref="GOA:A1SDX6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX6"
FT                   /protein_id="ABL80011.1"
FT                   /translation="MATDRSDDILRLRATLATIAPGTPLRDGLERILRGRTGALIVLGH
FT                   DKVVESISTGGFTLDVPFTATGLRELAKMDGAIIVDRDVTRIQRAAVHLMPDHTIPSEE
FT                   TGTRHRTADRVARQTGFPVISVSQSMQIIAAYVGETRHVLEDSGQILSRANQALATLER
FT                   YKLRLDEVSSTLSALEIEDLVTVRDVAVVAQRLEMVTRIASEIEDYVLELGTDGRLLSL
FT                   QLEELITGVDTERELVIRDYLPAGRRSKSPEALLNRLESLSSTELVDPAAAARALGLGN
FT                   GEHLDGAVAPRGFRLLAKVPRLPATVVDRLVDHFGTLQKLLSAGVDDLQAVEGVGELRA
FT                   RSVREGLSRLAESTILERYV"
     MATDRSDDIL RLRATLATIA PGTPLRDGLE RILRGRTGAL IVLGHDKVVE SISTGGFTLD        60
     VPFTATGLRE LAKMDGAIIV DRDVTRIQRA AVHLMPDHTI PSEETGTRHR TADRVARQTG       120
     FPVISVSQSM QIIAAYVGET RHVLEDSGQI LSRANQALAT LERYKLRLDE VSSTLSALEI       180
     EDLVTVRDVA VVAQRLEMVT RIASEIEDYV LELGTDGRLL SLQLEELITG VDTERELVIR       240
     DYLPAGRRSK SPEALLNRLE SLSSTELVDP AAAARALGLG NGEHLDGAVA PRGFRLLAKV       300
     PRLPATVVDR LVDHFGTLQK LLSAGVDDLQ AVEGVGELRA RSVREGLSRL AESTILERYV       360
//

If you have problems or comments...

PBIL Back to PBIL home page