(data stored in ACNUC1104 zone)

EMBL: CP000509.PE462

CP000509.PE462       Location/Qualifiers
FT   CDS             complement(501369..502787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0470"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: sma:SAV4710 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80012"
FT                   /db_xref="GOA:A1SDX7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX7"
FT                   /protein_id="ABL80012.1"
FT                   /translation="MAKSPHPAFRCSECGWETAKWVGRCGECQAWGSVAEAAAVPVGRT
FT                   PATPVSRPAVPIAQVSVEDSRFRTSGVPELDRVLGGGLVPGAAILLAGEPGVGKSTLLL
FT                   EVAAQTARYQRRTLYVTGEESASQVRLRADRTGGVHDELYLAAETDLGAVLTHIEEVRP
FT                   TLLVVDSIQTIGAAGVDGVPGGVTQVKEVAAALVRVAKTRNITTVIVGHVTKDGSIAGP
FT                   RVLEHVVDVVLHFEGDRESRFRMVRAMKNRFGPVDEVGCFDLGPEGITAVTDPTGVFVE
FT                   SHHSRVPGTCVAVTMEGRRPLLAEVQALVTHTSAERPRRTTSGLDSSRVAMVMAVLQQH
FT                   CGVHLHTRDVFASTVGGARITEPASDLAAAVALTSASRGLAAPRGVVAIGEIGLSGELR
FT                   RVRDLPLRLAEAARLGFQLAVVPTEPGRPAVRSPESWTVDGMQVLDVTDVGGALRLLRL
FT                   LDTEHEKPRSIEGR"
     MAKSPHPAFR CSECGWETAK WVGRCGECQA WGSVAEAAAV PVGRTPATPV SRPAVPIAQV        60
     SVEDSRFRTS GVPELDRVLG GGLVPGAAIL LAGEPGVGKS TLLLEVAAQT ARYQRRTLYV       120
     TGEESASQVR LRADRTGGVH DELYLAAETD LGAVLTHIEE VRPTLLVVDS IQTIGAAGVD       180
     GVPGGVTQVK EVAAALVRVA KTRNITTVIV GHVTKDGSIA GPRVLEHVVD VVLHFEGDRE       240
     SRFRMVRAMK NRFGPVDEVG CFDLGPEGIT AVTDPTGVFV ESHHSRVPGT CVAVTMEGRR       300
     PLLAEVQALV THTSAERPRR TTSGLDSSRV AMVMAVLQQH CGVHLHTRDV FASTVGGARI       360
     TEPASDLAAA VALTSASRGL AAPRGVVAIG EIGLSGELRR VRDLPLRLAE AARLGFQLAV       420
     VPTEPGRPAV RSPESWTVDG MQVLDVTDVG GALRLLRLLD TEHEKPRSIE GR               472
//

If you have problems or comments...

PBIL Back to PBIL home page