(data stored in ACNUC1104 zone)

EMBL: CP000509.PE463

CP000509.PE463       Location/Qualifiers
FT   CDS             503013..504032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0471"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sth:STH770
FT                   LacI family transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80013"
FT                   /db_xref="GOA:A1SDX8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX8"
FT                   /protein_id="ABL80013.1"
FT                   /translation="MARVSTTPPTLADVAERAGVSRQTVSNAVNNPDLLRADTLARVLH
FT                   AIDELGYSPNRAARNLRTRASHLVGMRIGPVYEGTANATMDRFVHSLVEASREAGYHVL
FT                   LFAGDPEDPVAGYDDLLRSTTVDAFVVTDTYLGNPQATWLEERRAPFVAFGRPWDNPAA
FT                   EHPWVDVDGAAGTDLATSYLLGRGHERIAWIGWRKDSWIGEDRRSGWSRALHARGLPTT
FT                   GLASRVEDTVSSGREASAVLLDEARPTAFVCASDTLAMGVLGTLADRGLTPGRDVSVIG
FT                   FDDSQVAQVVSPGLTSVRQPLEEVAVEIVKALEGLLGHPPTVGPGVMLVPSLALRGTS"
     MARVSTTPPT LADVAERAGV SRQTVSNAVN NPDLLRADTL ARVLHAIDEL GYSPNRAARN        60
     LRTRASHLVG MRIGPVYEGT ANATMDRFVH SLVEASREAG YHVLLFAGDP EDPVAGYDDL       120
     LRSTTVDAFV VTDTYLGNPQ ATWLEERRAP FVAFGRPWDN PAAEHPWVDV DGAAGTDLAT       180
     SYLLGRGHER IAWIGWRKDS WIGEDRRSGW SRALHARGLP TTGLASRVED TVSSGREASA       240
     VLLDEARPTA FVCASDTLAM GVLGTLADRG LTPGRDVSVI GFDDSQVAQV VSPGLTSVRQ       300
     PLEEVAVEIV KALEGLLGHP PTVGPGVMLV PSLALRGTS                              339
//

If you have problems or comments...

PBIL Back to PBIL home page