(data stored in SCRATCH zone)

EMBL: CP000509.PE464

CP000509.PE464       Location/Qualifiers
FT   CDS             complement(504157..504912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0472"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rha:RHA1_ro06583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80014"
FT                   /db_xref="GOA:A1SDX9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX9"
FT                   /protein_id="ABL80014.1"
FT                   /translation="MDDPRSHAIARPVRQLSRGRVRATEGARPSPNIWQHPATYEIENR
FT                   AVDPDGLLAAAMLAVDRWADRTVLDVGCGTGFHLPWFAETAASVIGVEPHADLVALARR
FT                   RSRRLANVTVHQGVAQSLPLPDASVDVVHARWAYFFGPGCEPGLAELDRVVRRGGTAYV
FT                   IDNDPTRSTFGGWFRRGYPEVDPVAVERFWSARGWTRVPLDLRWSFSSRADLEAVVRIE
FT                   FTPQVADQVLPEHAGTEVDYAVNLWWKRF"
     MDDPRSHAIA RPVRQLSRGR VRATEGARPS PNIWQHPATY EIENRAVDPD GLLAAAMLAV        60
     DRWADRTVLD VGCGTGFHLP WFAETAASVI GVEPHADLVA LARRRSRRLA NVTVHQGVAQ       120
     SLPLPDASVD VVHARWAYFF GPGCEPGLAE LDRVVRRGGT AYVIDNDPTR STFGGWFRRG       180
     YPEVDPVAVE RFWSARGWTR VPLDLRWSFS SRADLEAVVR IEFTPQVADQ VLPEHAGTEV       240
     DYAVNLWWKR F                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page