(data stored in ACNUC1104 zone)

EMBL: CP000509.PE467

CP000509.PE467       Location/Qualifiers
FT   CDS             506536..507471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0475"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: sco:SCO3348
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80017"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY2"
FT                   /protein_id="ABL80017.1"
FT                   /translation="MRLGVLDIGSNTGHLLVVDAHGGAAPLPAYSYKQPLRLAEHLDDE
FT                   GAVTRLGVDSLTAFTAQALVVAEDKGCQDMLAFATSAVRDAVNTDAVLDHVHAATGVRI
FT                   EVLPGEDEARLTFLAVRRWFGWSAGRLAVFDIGGGSLEIAGGADESPDVAWSLPIGAGR
FT                   LARQFFSGGPPDDEAIRGLRKQLRAEIARDAGHLLRAGTPDHAAATSKTFRSLARICGA
FT                   APSADGPLVPRVLEREVLREWIPKLVTMAPEALAHLPGVSPSRAHQIVTGALVAEAAMD
FT                   IFGLELLEVCPWALREGVILERLDQISVLG"
     MRLGVLDIGS NTGHLLVVDA HGGAAPLPAY SYKQPLRLAE HLDDEGAVTR LGVDSLTAFT        60
     AQALVVAEDK GCQDMLAFAT SAVRDAVNTD AVLDHVHAAT GVRIEVLPGE DEARLTFLAV       120
     RRWFGWSAGR LAVFDIGGGS LEIAGGADES PDVAWSLPIG AGRLARQFFS GGPPDDEAIR       180
     GLRKQLRAEI ARDAGHLLRA GTPDHAAATS KTFRSLARIC GAAPSADGPL VPRVLEREVL       240
     REWIPKLVTM APEALAHLPG VSPSRAHQIV TGALVAEAAM DIFGLELLEV CPWALREGVI       300
     LERLDQISVL G                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page