(data stored in ACNUC1104 zone)

EMBL: CP000509.PE469

CP000509.PE469       Location/Qualifiers
FT   CDS             508259..508867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0477"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   rha:RHA1_ro00946 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80019"
FT                   /db_xref="GOA:A1SDY4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY4"
FT                   /protein_id="ABL80019.1"
FT                   /translation="MTDPATRAAPRRGRRPGTPDTRAAILAAARELFAAQGYAGTSVRA
FT                   IGAAAGVDASLVHHYFGTKDDLFVAALELRVDPRVVVPPVFEGGLESAGERLMRLFVSV
FT                   WDDEEKRLPLLALIRGALDSGGQQLVRDGFMRMVLEPLAAGLGVADQRRMPLVASQLLG
FT                   LVLLRYLLVVEPLASMPADELVALYGPTLQRYLSGPLPD"
     MTDPATRAAP RRGRRPGTPD TRAAILAAAR ELFAAQGYAG TSVRAIGAAA GVDASLVHHY        60
     FGTKDDLFVA ALELRVDPRV VVPPVFEGGL ESAGERLMRL FVSVWDDEEK RLPLLALIRG       120
     ALDSGGQQLV RDGFMRMVLE PLAAGLGVAD QRRMPLVASQ LLGLVLLRYL LVVEPLASMP       180
     ADELVALYGP TLQRYLSGPL PD                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page