(data stored in ACNUC1104 zone)

EMBL: CP000509.PE47

CP000509.PE47        Location/Qualifiers
FT   CDS             complement(52863..54101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0047"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mes:Meso_2971 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79597"
FT                   /db_xref="GOA:A1SCR2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR2"
FT                   /protein_id="ABL79597.1"
FT                   /translation="MVKAEAAVLPLSGVRVVDLTRALSGPFCTMLLGDQGAEVVKIERP
FT                   VVGDDTRRQSNPMVGTENSAFLAVNRNKRSVAVDLRAEAGVEVVRRLVAVSDVVVENFR
FT                   PGKAEQMGLGYEQLRELNPGLVYCSISGWGSDGPYAARGGYASTAEAAGGLMSVTGERG
FT                   RGPVKVGVSIVDSLTGLYAKDAITAALLARVRTGVGQKVETSLLESTVSILSMSAYAYL
FT                   LGGVVAGRWGSEHQWNVPWKAFETTDGYVVVASSSEEQWRKICVGIERPDLLEDPRFTT
FT                   MADRAAHREILYALLDEVFATHTTHDWVARLDAVGAAAAPVNTIDQVFADPQVLARDML
FT                   QSVEHPTLGPIAQVGHAQKLHGTPHQITLPPPLLGQHTREVLTDLGGYTPDEIDELARD
FT                   GVVGVADHPAATA"
     MVKAEAAVLP LSGVRVVDLT RALSGPFCTM LLGDQGAEVV KIERPVVGDD TRRQSNPMVG        60
     TENSAFLAVN RNKRSVAVDL RAEAGVEVVR RLVAVSDVVV ENFRPGKAEQ MGLGYEQLRE       120
     LNPGLVYCSI SGWGSDGPYA ARGGYASTAE AAGGLMSVTG ERGRGPVKVG VSIVDSLTGL       180
     YAKDAITAAL LARVRTGVGQ KVETSLLEST VSILSMSAYA YLLGGVVAGR WGSEHQWNVP       240
     WKAFETTDGY VVVASSSEEQ WRKICVGIER PDLLEDPRFT TMADRAAHRE ILYALLDEVF       300
     ATHTTHDWVA RLDAVGAAAA PVNTIDQVFA DPQVLARDML QSVEHPTLGP IAQVGHAQKL       360
     HGTPHQITLP PPLLGQHTRE VLTDLGGYTP DEIDELARDG VVGVADHPAA TA               412
//

If you have problems or comments...

PBIL Back to PBIL home page