(data stored in ACNUC1104 zone)

EMBL: CP000509.PE473

CP000509.PE473       Location/Qualifiers
FT   CDS             511592..512395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0481"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: sma:SAV4724 putative pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80023"
FT                   /db_xref="GOA:A1SDY8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY8"
FT                   /protein_id="ABL80023.1"
FT                   /translation="MSQTAILGAGVMGETLLSGLVRAGRRVDHLLVGEKRPERAQELEE
FT                   RYGVAVVGNAEAARKADTLALVVKPQDMGDLLEEIAGELRPGQLVVSLAAGITTAFIEA
FT                   RVPEGVAVVRVMPNTPALVDEGMAAVSPGSHCSEEHLAEAESLMASVGRVLRIPERQQD
FT                   AVTAISGSGPAYIFFVVESMIEAGVHLGLPRATATDLVVQTVVGSAKMLRETGTHPAVL
FT                   REQVTSPAGTTAAALRELEIHKVRAAFLAAMEAARDRSRALAEGS"
     MSQTAILGAG VMGETLLSGL VRAGRRVDHL LVGEKRPERA QELEERYGVA VVGNAEAARK        60
     ADTLALVVKP QDMGDLLEEI AGELRPGQLV VSLAAGITTA FIEARVPEGV AVVRVMPNTP       120
     ALVDEGMAAV SPGSHCSEEH LAEAESLMAS VGRVLRIPER QQDAVTAISG SGPAYIFFVV       180
     ESMIEAGVHL GLPRATATDL VVQTVVGSAK MLRETGTHPA VLREQVTSPA GTTAAALREL       240
     EIHKVRAAFL AAMEAARDRS RALAEGS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page