(data stored in ACNUC1104 zone)

EMBL: CP000509.PE476

CP000509.PE476       Location/Qualifiers
FT   CDS             514976..515179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0484"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: Prophage CP4-57 regulatory; KEGG: cef:CE0431
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80026"
FT                   /db_xref="GOA:A1SDZ1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ1"
FT                   /protein_id="ABL80026.1"
FT                   /translation="MATNPGDSSSSKFLTVAEVAAMMRVSKMTVYRLVHNGELPAVRVG
FT                   RSFRVQEKDVDEYLRKSFYSAG"
     MATNPGDSSS SKFLTVAEVA AMMRVSKMTV YRLVHNGELP AVRVGRSFRV QEKDVDEYLR        60
     KSFYSAG                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page