(data stored in ACNUC1104 zone)

EMBL: CP000509.PE481

CP000509.PE481       Location/Qualifiers
FT   CDS             complement(519078..519878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0489"
FT                   /product="sigma-70 region 2 domain protein"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sma:SAV4735 RNA polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80031"
FT                   /db_xref="GOA:A1SDZ6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ6"
FT                   /protein_id="ABL80031.1"
FT                   /translation="MSWEDTDVARGLDALRRLVAHVLVLEQPQLAGTPGMLATEAVASG
FT                   RAEMRAKTRPKSGPGTGDGGPDGYGDAELATSSEEDEAERSRLIALVELARKGDADAFG
FT                   LLYDHYQPSVYRFLFYRTRSGTLAEDLTSETFFRALRSMNNFRWQGKDFGAWLMTIARN
FT                   LATDHFKAGRTRLELTTEDMGLHDDATEGPESMVLAGLTNELLLHALTELPPEQRDCLV
FT                   MRFLQGMSIAETAAVLGRSDGAVKQLQLRGVRNLAKLMPEGIRD"
     MSWEDTDVAR GLDALRRLVA HVLVLEQPQL AGTPGMLATE AVASGRAEMR AKTRPKSGPG        60
     TGDGGPDGYG DAELATSSEE DEAERSRLIA LVELARKGDA DAFGLLYDHY QPSVYRFLFY       120
     RTRSGTLAED LTSETFFRAL RSMNNFRWQG KDFGAWLMTI ARNLATDHFK AGRTRLELTT       180
     EDMGLHDDAT EGPESMVLAG LTNELLLHAL TELPPEQRDC LVMRFLQGMS IAETAAVLGR       240
     SDGAVKQLQL RGVRNLAKLM PEGIRD                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page