(data stored in SCRATCH zone)

EMBL: CP000509.PE482

CP000509.PE482       Location/Qualifiers
FT   CDS             complement(520088..520981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0490"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV4736 3-phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80032"
FT                   /db_xref="GOA:A1SDZ7"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ7"
FT                   /protein_id="ABL80032.1"
FT                   /translation="MTPAHDRRARPRNLQLRSVLAGEAAAAAAEVESALTPPLDPVAAA
FT                   FFDVDNTVMQGASIFHLARGLHRRKFFTTREILGAAWKQAYFRVVGVEDPAHVADARAS
FT                   ALGFIAGHTVTELQDLGEEIFEEAMADRIWPGTRALAQLHLDEGQRVWLVTAAPIEIAQ
FT                   IIARRLGLTGALGTVAEHIDGVYTGRLVGDLLHGPAKGEAVRALAAREGLDLHRCSAYS
FT                   DSFNDLPMLTMVGDPCAINPDARLRAHAREQGWRIHDYRTGRKALRAGLVAGGIAGAAS
FT                   GTVAAGLALRGRRFPR"
     MTPAHDRRAR PRNLQLRSVL AGEAAAAAAE VESALTPPLD PVAAAFFDVD NTVMQGASIF        60
     HLARGLHRRK FFTTREILGA AWKQAYFRVV GVEDPAHVAD ARASALGFIA GHTVTELQDL       120
     GEEIFEEAMA DRIWPGTRAL AQLHLDEGQR VWLVTAAPIE IAQIIARRLG LTGALGTVAE       180
     HIDGVYTGRL VGDLLHGPAK GEAVRALAAR EGLDLHRCSA YSDSFNDLPM LTMVGDPCAI       240
     NPDARLRAHA REQGWRIHDY RTGRKALRAG LVAGGIAGAA SGTVAAGLAL RGRRFPR          297
//

If you have problems or comments...

PBIL Back to PBIL home page