(data stored in ACNUC1104 zone)

EMBL: CP000509.PE485

CP000509.PE485       Location/Qualifiers
FT   CDS             523011..523688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0493"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sma:SAV4738 putative AT-rich
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80035"
FT                   /db_xref="GOA:A1SE00"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE00"
FT                   /protein_id="ABL80035.1"
FT                   /translation="METRSVSARTSPESARDIPEATVARLPVYLRALVTLSEQGTATCS
FT                   SEELAVAAGVNSAKLRKDLSYLGSYGTRGVGYDVDYLRYQIAREIGVTQDWPVVIVGIG
FT                   NLGQALANYSGFRSRGFRVVALLDADPARHDQVVAGIEVRPFDHLERIVRDHAVAIGVI
FT                   ATPAVAAQDVADRMVAYGITSILNFAPTVLTVPAEVDVRKVDLSIELQILAYHEQRKGA
FT                   VTA"
     METRSVSART SPESARDIPE ATVARLPVYL RALVTLSEQG TATCSSEELA VAAGVNSAKL        60
     RKDLSYLGSY GTRGVGYDVD YLRYQIAREI GVTQDWPVVI VGIGNLGQAL ANYSGFRSRG       120
     FRVVALLDAD PARHDQVVAG IEVRPFDHLE RIVRDHAVAI GVIATPAVAA QDVADRMVAY       180
     GITSILNFAP TVLTVPAEVD VRKVDLSIEL QILAYHEQRK GAVTA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page