(data stored in ACNUC1104 zone)

EMBL: CP000509.PE490

CP000509.PE490       Location/Qualifiers
FT   CDS             complement(528934..530103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0498"
FT                   /product="secreted protein"
FT                   /note="KEGG: sma:SAV6229 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80040"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE05"
FT                   /protein_id="ABL80040.1"
FT                   /translation="MPTRSTRFGRGQKVMALVPLALLSAAWTASIAGVGASTATASAES
FT                   ESTALPDGSTVPTEAIKAPASVSTSGGLAPGVRGDGAGIVSTASTSGIPSAALAAYQRA
FT                   ETVINAADKSCHLSWQLIAAIGRVESDHGRTNGNTLDAQGVARPGIYGIALDGSHGTTR
FT                   ITDTDAGQYDADARFDRAIGPMQFIPSTWSVVGVDADGDGQRNPQDVDDAALATAVYLC
FT                   SGSDDLSTPAGQRAAVYRYNHSSSYVDLVLSIAAAYLDGDFTSVPNGTTSAGYLVPAPA
FT                   KPGQQGPKKHHGQPHATQTQGPGGGSQQPAPEPSPEPTAPAAPNPTGGGGGGDLPVPSV
FT                   PPLPSTSIPPVDELLTVAQAIVQCTLDGYVDNILKDDDAFDQCVYDYTH"
     MPTRSTRFGR GQKVMALVPL ALLSAAWTAS IAGVGASTAT ASAESESTAL PDGSTVPTEA        60
     IKAPASVSTS GGLAPGVRGD GAGIVSTAST SGIPSAALAA YQRAETVINA ADKSCHLSWQ       120
     LIAAIGRVES DHGRTNGNTL DAQGVARPGI YGIALDGSHG TTRITDTDAG QYDADARFDR       180
     AIGPMQFIPS TWSVVGVDAD GDGQRNPQDV DDAALATAVY LCSGSDDLST PAGQRAAVYR       240
     YNHSSSYVDL VLSIAAAYLD GDFTSVPNGT TSAGYLVPAP AKPGQQGPKK HHGQPHATQT       300
     QGPGGGSQQP APEPSPEPTA PAAPNPTGGG GGGDLPVPSV PPLPSTSIPP VDELLTVAQA       360
     IVQCTLDGYV DNILKDDDAF DQCVYDYTH                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page