(data stored in SCRATCH zone)

EMBL: CP000509.PE493

CP000509.PE493       Location/Qualifiers
FT   CDS             532363..532965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0501"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pac:PPA0325
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80043"
FT                   /db_xref="GOA:A1SE08"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE08"
FT                   /protein_id="ABL80043.1"
FT                   /translation="MTRLRRSLGAGAVGLLLLTGCSSLEGTGDKGYISGDQRVRVVDPA
FT                   DRGSAVELTGTSLTGDPVDVADSRGRVLVVNTWWSGCAPCRSEMPMLTAAAKELGERAD
FT                   FLGINIRDASASQGQAFIRSVGAEYPSIYDPTGKAVLAFAGKTTLSAIPTTIVLDAEGR
FT                   VAAVITGEIPSKQTLVDVVDEVAANAAAESGGETADG"
     MTRLRRSLGA GAVGLLLLTG CSSLEGTGDK GYISGDQRVR VVDPADRGSA VELTGTSLTG        60
     DPVDVADSRG RVLVVNTWWS GCAPCRSEMP MLTAAAKELG ERADFLGINI RDASASQGQA       120
     FIRSVGAEYP SIYDPTGKAV LAFAGKTTLS AIPTTIVLDA EGRVAAVITG EIPSKQTLVD       180
     VVDEVAANAA AESGGETADG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page