(data stored in ACNUC1104 zone)

EMBL: CP000509.PE495

CP000509.PE495       Location/Qualifiers
FT   CDS             533802..535400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0503"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: sco:SCO4474
FT                   putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80045"
FT                   /db_xref="GOA:A1SE10"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE10"
FT                   /protein_id="ABL80045.1"
FT                   /translation="MSTPTRTSLSTRPPEDDRRPGELTLRELLRWTWRQLTSMRTALVL
FT                   LLLLALAAVPGSIIPQEGVDSLKTSNWRSDHPKLTPVYERLGLFSVYDSPWFSAIYLLL
FT                   MVSLVGCIIPRAILYWRGMWAQPPAAPRNLTRLPDHATYQTAVAPDAVLERARATLRRR
FT                   RYRLSPEAGDAVAAERGYLREAGNLLFHLAVVVVLVGFALGGLFGYKGGVILLVGDGYG
FT                   FSNNLTQYDDFDPGSLFRDSDMEPFSFSIDDFSVEWLTSGPRAGMARGFESHLTYRESP
FT                   DAPDRTYDLKVNHPLSIGNTDVFLIGHGYAPVLTIRDGDGEEVYSGPTIFLPTDQSFQS
FT                   IGVVKAPDAEPTQIGLEGEFYPTVAFSKQTGSYFSLFGRPLDPLVSMLVYTGDLGMDDG
FT                   QPQSVYSLDKSRTTMLTKANGAPYRIDLRPGEQVTLPDGLGTVSFDGLERWNKIQISQT
FT                   PGKWIALIGVVLALLGLLGSLFIRPRRVWVRARRDGDGTLVEVAALDRSGGGDVAVVVA
FT                   QLVTDLQQPDREDNS"
     MSTPTRTSLS TRPPEDDRRP GELTLRELLR WTWRQLTSMR TALVLLLLLA LAAVPGSIIP        60
     QEGVDSLKTS NWRSDHPKLT PVYERLGLFS VYDSPWFSAI YLLLMVSLVG CIIPRAILYW       120
     RGMWAQPPAA PRNLTRLPDH ATYQTAVAPD AVLERARATL RRRRYRLSPE AGDAVAAERG       180
     YLREAGNLLF HLAVVVVLVG FALGGLFGYK GGVILLVGDG YGFSNNLTQY DDFDPGSLFR       240
     DSDMEPFSFS IDDFSVEWLT SGPRAGMARG FESHLTYRES PDAPDRTYDL KVNHPLSIGN       300
     TDVFLIGHGY APVLTIRDGD GEEVYSGPTI FLPTDQSFQS IGVVKAPDAE PTQIGLEGEF       360
     YPTVAFSKQT GSYFSLFGRP LDPLVSMLVY TGDLGMDDGQ PQSVYSLDKS RTTMLTKANG       420
     APYRIDLRPG EQVTLPDGLG TVSFDGLERW NKIQISQTPG KWIALIGVVL ALLGLLGSLF       480
     IRPRRVWVRA RRDGDGTLVE VAALDRSGGG DVAVVVAQLV TDLQQPDRED NS               532
//

If you have problems or comments...

PBIL Back to PBIL home page