(data stored in ACNUC1104 zone)

EMBL: CP000509.PE50

CP000509.PE50        Location/Qualifiers
FT   CDS             58431..59273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79600"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR5"
FT                   /protein_id="ABL79600.1"
FT                   /translation="MKAFISSVRRGLGPERDYLAELILACGHTPLRFEDFGAQDLTSRG
FT                   ACLGGVQEADVYLLILGPHYGTEVDDSGLSPTEEEFNVAMERGIPVYVFVKSGIEVDQA
FT                   QREFMDRVGNYKDGRFWAEFADNAQLGVHVARVLREHREPAPPFRQMALTRQVQVPWRT
FT                   GQLSVPQTRDGSPVLEVHVLPIESTALRPVAHLAALAVQLASDARRQGFFGHGDALDIA
FT                   SDTELAWAVRAEDRGRRGGWNEVRLDPSPASTPPGAARSPSFRPCRVTRSAAWSTSRT"
     MKAFISSVRR GLGPERDYLA ELILACGHTP LRFEDFGAQD LTSRGACLGG VQEADVYLLI        60
     LGPHYGTEVD DSGLSPTEEE FNVAMERGIP VYVFVKSGIE VDQAQREFMD RVGNYKDGRF       120
     WAEFADNAQL GVHVARVLRE HREPAPPFRQ MALTRQVQVP WRTGQLSVPQ TRDGSPVLEV       180
     HVLPIESTAL RPVAHLAALA VQLASDARRQ GFFGHGDALD IASDTELAWA VRAEDRGRRG       240
     GWNEVRLDPS PASTPPGAAR SPSFRPCRVT RSAAWSTSRT                             280
//

If you have problems or comments...

PBIL Back to PBIL home page