(data stored in ACNUC1104 zone)

EMBL: CP000509.PE501

CP000509.PE501       Location/Qualifiers
FT   CDS             539330..540292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0509"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, C-terminal domain protein; KEGG: tfu:Tfu_1410
FT                   O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80051"
FT                   /db_xref="GOA:A1SE16"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE16"
FT                   /protein_id="ABL80051.1"
FT                   /translation="MGMIVWSVPMRTRFRGITVREGVLLRGPADAERPGWGEWSPFLEY
FT                   DAAVAEPWLRCAEEAAAGDWPAPLRDRVPVNVTVPAVGPQQAHAIVLAGGCRTAKVKVA
FT                   EPGQTAADDQARLEAVRDALGADGRVRIDVNGLWDLDTAVASIPVLDRAAGGLEYVEQP
FT                   CASVEDLAAVRRRVDVPIAADESIRRAADPYRVRDLEAADVAVLKVQPLGGVRACLRIA
FT                   EDIGLPVVVSSALETSVGIAAGVALAAALPELPYACGLATVQLLTADVVTESLLPVGGE
FT                   LPVRAVQVDESLAPADPDRVAHWEARLAEVRALRQDRPS"
     MGMIVWSVPM RTRFRGITVR EGVLLRGPAD AERPGWGEWS PFLEYDAAVA EPWLRCAEEA        60
     AAGDWPAPLR DRVPVNVTVP AVGPQQAHAI VLAGGCRTAK VKVAEPGQTA ADDQARLEAV       120
     RDALGADGRV RIDVNGLWDL DTAVASIPVL DRAAGGLEYV EQPCASVEDL AAVRRRVDVP       180
     IAADESIRRA ADPYRVRDLE AADVAVLKVQ PLGGVRACLR IAEDIGLPVV VSSALETSVG       240
     IAAGVALAAA LPELPYACGL ATVQLLTADV VTESLLPVGG ELPVRAVQVD ESLAPADPDR       300
     VAHWEARLAE VRALRQDRPS                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page