(data stored in ACNUC1104 zone)

EMBL: CP000509.PE508

CP000509.PE508       Location/Qualifiers
FT   CDS             complement(547044..548330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0516"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthases; PFAM: Anthranilate
FT                   synthase component I and chorismate binding protein; KEGG:
FT                   tfu:Tfu_1413 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80058"
FT                   /db_xref="GOA:A1SE23"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE23"
FT                   /protein_id="ABL80058.1"
FT                   /translation="MSTLGRVTSSPTPGDPPPAPADALVVRTVRLDLDQAASLLDLVPA
FT                   DRPVTWLRRGDGLVGWGVAAQVRTSGATRFADAVKWWSETIARADVHDDVNEPGTGLVS
FT                   FGSFAFADDPGDSILVLPRVVVGRRGDVTWLTTVGEVGPPLGPVERPAAPAAVSFADGA
FT                   LNGEQWMSVVADAVARINAGDLEKVVLARDLVATASDPVDVRWPLGRLGETYPMCWTFH
FT                   VDGMFGATPEMLVRRERGLVTSRVLAGTIRRTGDHERDLALAATLAHSSKDLEEHEYAV
FT                   RSVADALEPHCSSMNVPEAPFVLHLPNVMHLATDVAGVVHDAATVSSLQLAEALHPSAA
FT                   VGGTPTPVATALIADIEGMDRDRYAGPVGWMDASGDGEWGIALRSARLEGRTVRLFAGC
FT                   GIVADSDPAAELAEAQAKFVPVRDALTAS"
     MSTLGRVTSS PTPGDPPPAP ADALVVRTVR LDLDQAASLL DLVPADRPVT WLRRGDGLVG        60
     WGVAAQVRTS GATRFADAVK WWSETIARAD VHDDVNEPGT GLVSFGSFAF ADDPGDSILV       120
     LPRVVVGRRG DVTWLTTVGE VGPPLGPVER PAAPAAVSFA DGALNGEQWM SVVADAVARI       180
     NAGDLEKVVL ARDLVATASD PVDVRWPLGR LGETYPMCWT FHVDGMFGAT PEMLVRRERG       240
     LVTSRVLAGT IRRTGDHERD LALAATLAHS SKDLEEHEYA VRSVADALEP HCSSMNVPEA       300
     PFVLHLPNVM HLATDVAGVV HDAATVSSLQ LAEALHPSAA VGGTPTPVAT ALIADIEGMD       360
     RDRYAGPVGW MDASGDGEWG IALRSARLEG RTVRLFAGCG IVADSDPAAE LAEAQAKFVP       420
     VRDALTAS                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page