(data stored in ACNUC1104 zone)

EMBL: CP000509.PE510

CP000509.PE510       Location/Qualifiers
FT   CDS             complement(549035..549964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0518"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: sma:SAV3383
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80060"
FT                   /db_xref="GOA:A1SE25"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE25"
FT                   /protein_id="ABL80060.1"
FT                   /translation="MLLARRLLLLVAVAALLCAAAFVAGDALDGGSSARPAASGAGAAS
FT                   TDQPATTDPTAAPSSSDPTATPGSSPTDAPAPTAADEPTRQPTHLPTRQPTLVPGPRLL
FT                   GPGDQGDEVRDLQARLKQIYWFNTDVTGVYGDVTATAVRGFQAKREIPVTGEVDQRTLD
FT                   RLRAMTSTPTGAELHNRGNTPGALDARCRTGRVLCIDKTSSTLRWVVDGTVRQTLDVRF
FT                   GASTTPTREGVFHVYLKDADHVSRLYGSAMPYSMFFSGGQAVHYSSDFAAVGYAGASHG
FT                   CVNVRDYDALGLLYGQVRVGDTVVVYWS"
     MLLARRLLLL VAVAALLCAA AFVAGDALDG GSSARPAASG AGAASTDQPA TTDPTAAPSS        60
     SDPTATPGSS PTDAPAPTAA DEPTRQPTHL PTRQPTLVPG PRLLGPGDQG DEVRDLQARL       120
     KQIYWFNTDV TGVYGDVTAT AVRGFQAKRE IPVTGEVDQR TLDRLRAMTS TPTGAELHNR       180
     GNTPGALDAR CRTGRVLCID KTSSTLRWVV DGTVRQTLDV RFGASTTPTR EGVFHVYLKD       240
     ADHVSRLYGS AMPYSMFFSG GQAVHYSSDF AAVGYAGASH GCVNVRDYDA LGLLYGQVRV       300
     GDTVVVYWS                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page