(data stored in ACNUC1104 zone)

EMBL: CP000509.PE512

CP000509.PE512       Location/Qualifiers
FT   CDS             551159..551518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0520"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: sma:SAV4837 putative NADH dehydrogenase
FT                   chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80062"
FT                   /db_xref="GOA:A1SE27"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE27"
FT                   /protein_id="ABL80062.1"
FT                   /translation="MELYTPVVVLVVLATVFALGGAVMAFAVGPTRYNRVKLDSYECGI
FT                   EPTPQAVGGGRFPIKYYITAMLFIVFDIEIVFLYPWAVQFDELKFFGLVEMVLFIATVF
FT                   VAYAYVWRRGGLDWD"
     MELYTPVVVL VVLATVFALG GAVMAFAVGP TRYNRVKLDS YECGIEPTPQ AVGGGRFPIK        60
     YYITAMLFIV FDIEIVFLYP WAVQFDELKF FGLVEMVLFI ATVFVAYAYV WRRGGLDWD        119
//

If you have problems or comments...

PBIL Back to PBIL home page