(data stored in SCRATCH zone)

EMBL: CP000509.PE513

CP000509.PE513       Location/Qualifiers
FT   CDS             551532..552086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0521"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tfu:Tfu_2694 NADH dehydrogenase (ubiquinone),
FT                   20 kDa subunit; TIGRFAM: NADH-quinone oxidoreductase, B
FT                   subunit; PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80063"
FT                   /db_xref="GOA:A1SE28"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE28"
FT                   /protein_id="ABL80063.1"
FT                   /translation="MGIEEKLPSGVLLSTVEGLAGYMRKASFWPASFGLACCAIEMMTS
FT                   GGPKHDLGRFGMEVFRASPRQADVMIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVCA
FT                   SSGGMFNNYAVVQGVDHVVPVDMYLPGCPPRPQMLIDAILKLHDKVQHTKMGAHRAAEI
FT                   EELETAALRALPTSEMKGQLR"
     MGIEEKLPSG VLLSTVEGLA GYMRKASFWP ASFGLACCAI EMMTSGGPKH DLGRFGMEVF        60
     RASPRQADVM IVAGRVSQKM APVLRQIYDQ MPEPKWVLAM GVCASSGGMF NNYAVVQGVD       120
     HVVPVDMYLP GCPPRPQMLI DAILKLHDKV QHTKMGAHRA AEIEELETAA LRALPTSEMK       180
     GQLR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page