(data stored in ACNUC1104 zone)

EMBL: CP000509.PE514

CP000509.PE514       Location/Qualifiers
FT   CDS             552083..552835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0522"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone), 30 kDa subunit;
FT                   KEGG: rha:RHA1_ro05911 probable NADH dehydrogenase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80064"
FT                   /db_xref="GOA:A1SE29"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE29"
FT                   /protein_id="ABL80064.1"
FT                   /translation="MSDDSSDVKPGPKGPEQPAVEQSPENVPAPTGEVHQVGARHGMFG
FT                   VRGTGDTSGYGGLNQAIVLPGDAQRPYGGWFDEVADGLAAATREAGLEIAAPRVVIHRG
FT                   EITFHLRREDLLPVAQVLRDDERLRFEFCAGVSGVHYPDETGRELHAVYHLLSMTHNRR
FT                   IRLEVAVPDADPHIPSIVPVYPTNDWHERETYDMFGIIFDGHPALTRILMPDDWPGHPQ
FT                   RKDYPLGGVPVEYKGGTVPPPDQRRSYN"
     MSDDSSDVKP GPKGPEQPAV EQSPENVPAP TGEVHQVGAR HGMFGVRGTG DTSGYGGLNQ        60
     AIVLPGDAQR PYGGWFDEVA DGLAAATREA GLEIAAPRVV IHRGEITFHL RREDLLPVAQ       120
     VLRDDERLRF EFCAGVSGVH YPDETGRELH AVYHLLSMTH NRRIRLEVAV PDADPHIPSI       180
     VPVYPTNDWH ERETYDMFGI IFDGHPALTR ILMPDDWPGH PQRKDYPLGG VPVEYKGGTV       240
     PPPDQRRSYN                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page