(data stored in ACNUC1104 zone)

EMBL: CP000509.PE515

CP000509.PE515       Location/Qualifiers
FT   CDS             552835..554175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0523"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: sco:SCO4565 NADH dehydrogenase I chain D;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase, chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80065"
FT                   /db_xref="GOA:A1SE30"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE30"
FT                   /protein_id="ABL80065.1"
FT                   /translation="MADQDLYSGSSETTEGRVFTVTGQDWDSIAEGLAEDEAQERIVVN
FT                   MGPQHPSTHGVLRLILELEGETVTEARAGIGYLHTGIEKNMEYRTWTQGVTFCTRMDYL
FT                   SPFFNEMTYVLGIERLLDIEDRVPEKAQVMRVLLMELNRISSHLVAIATGGMELGALTV
FT                   MTIGFRERELVLDLFELITGLRMNHAFIRPGGVAQDMPPGALDEIRGFVALMKKRLPEY
FT                   ADLCNANPIFKGRLEGIGHLDLAGCLALGLTGPVLRSTGYPWDLRKTQPYCGYETYDFD
FT                   VQTWDTSDSYGRFRIRLNEMWESLRIIEQAADRLAGLDGAPVMIEDKKIGWPSQLAIGS
FT                   DGMGNSLDHIRHIMGESMEALIHHFKLVTEGFRVPPGQAYVPVESPRGELGAHVVSDGG
FT                   TRPFRAHFRDPSFTNLQATSVMAEGGMVADVIVAIASIDPVMGGVDR"
     MADQDLYSGS SETTEGRVFT VTGQDWDSIA EGLAEDEAQE RIVVNMGPQH PSTHGVLRLI        60
     LELEGETVTE ARAGIGYLHT GIEKNMEYRT WTQGVTFCTR MDYLSPFFNE MTYVLGIERL       120
     LDIEDRVPEK AQVMRVLLME LNRISSHLVA IATGGMELGA LTVMTIGFRE RELVLDLFEL       180
     ITGLRMNHAF IRPGGVAQDM PPGALDEIRG FVALMKKRLP EYADLCNANP IFKGRLEGIG       240
     HLDLAGCLAL GLTGPVLRST GYPWDLRKTQ PYCGYETYDF DVQTWDTSDS YGRFRIRLNE       300
     MWESLRIIEQ AADRLAGLDG APVMIEDKKI GWPSQLAIGS DGMGNSLDHI RHIMGESMEA       360
     LIHHFKLVTE GFRVPPGQAY VPVESPRGEL GAHVVSDGGT RPFRAHFRDP SFTNLQATSV       420
     MAEGGMVADV IVAIASIDPV MGGVDR                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page