(data stored in SCRATCH zone)

EMBL: CP000509.PE518

CP000509.PE518       Location/Qualifiers
FT   CDS             556279..558714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0526"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   ferredoxin; molybdopterin oxidoreductase; KEGG:
FT                   tfu:Tfu_2689 NADH-quinone oxidoreductase, chain G"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80068"
FT                   /db_xref="GOA:A1SE33"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE33"
FT                   /protein_id="ABL80068.1"
FT                   /translation="MTSTPEKAAVDTVSVTIDGIQVDVPKGTLVIRAAEQIGVQIPRFC
FT                   DHPLLAPVGACRQCLVDIPDAGNGRGFPKPQASCTLPVADGMVVNTQATSPVADKAQQG
FT                   IMEFLLVNHPLDCPVCDKGGECPLQNQAMSNGRGESRFTGVKRTYPKPINISAQVLLDR
FT                   ERCILCARCTRFSEQIAGDPFIALIERGALQQVGIYEREPFESYFSGNTIQICPVGALT
FT                   SADYRFRSRPFDLVSTPSVAEHDACGSAIRVDHRRGRVMRRLAGNDPEVNEEWITDKDR
FT                   FGFHYATEPDRLTYPQVRDRVEDGGDGGLRPASWTEAFAVAARGLQAAGATAVLTGGRV
FT                   TAEDAYAYSKFARVSLGTNDIDFRSRPLSAEEASFLAAEVVLRGPGNGGVTYGDLEAAK
FT                   TVVLAGLEPEDEAGMIFLRLRKASKPGRPGGGTRVVAIAPYATRSLTKMRGQLLRTAPG
FT                   DEAAALESLSSHAEFGVDSTAVILVGERLATVPGALSAAAALAARTGARLAWVPRRAGD
FT                   RGAVETGCLPNLLPGGRPVADAGARVDAATTWGVDSLPDAPGRDADAIVAALRAGEVRG
FT                   LVVGGVDPDDTSDPAATRAAVEAASFVVALELRETELTRAADVVFPVAPVADRAGTFVS
FT                   WEGRPRPFPAVFSRPTSLPDLRILAGIAEELSALGAGRELGFRTVEEARAQMEEMGPWD
FT                   GQRAALDTVSAPTAPVGEGLALATWKLLIDNGVMQDGDKAYRATGRKPVARLGRATYDA
FT                   VGPTVTLTGDRGSVTLPAEPADLDDGVVWVPANSFGNGVLADLASPGSRVTVAKGADA"
     MTSTPEKAAV DTVSVTIDGI QVDVPKGTLV IRAAEQIGVQ IPRFCDHPLL APVGACRQCL        60
     VDIPDAGNGR GFPKPQASCT LPVADGMVVN TQATSPVADK AQQGIMEFLL VNHPLDCPVC       120
     DKGGECPLQN QAMSNGRGES RFTGVKRTYP KPINISAQVL LDRERCILCA RCTRFSEQIA       180
     GDPFIALIER GALQQVGIYE REPFESYFSG NTIQICPVGA LTSADYRFRS RPFDLVSTPS       240
     VAEHDACGSA IRVDHRRGRV MRRLAGNDPE VNEEWITDKD RFGFHYATEP DRLTYPQVRD       300
     RVEDGGDGGL RPASWTEAFA VAARGLQAAG ATAVLTGGRV TAEDAYAYSK FARVSLGTND       360
     IDFRSRPLSA EEASFLAAEV VLRGPGNGGV TYGDLEAAKT VVLAGLEPED EAGMIFLRLR       420
     KASKPGRPGG GTRVVAIAPY ATRSLTKMRG QLLRTAPGDE AAALESLSSH AEFGVDSTAV       480
     ILVGERLATV PGALSAAAAL AARTGARLAW VPRRAGDRGA VETGCLPNLL PGGRPVADAG       540
     ARVDAATTWG VDSLPDAPGR DADAIVAALR AGEVRGLVVG GVDPDDTSDP AATRAAVEAA       600
     SFVVALELRE TELTRAADVV FPVAPVADRA GTFVSWEGRP RPFPAVFSRP TSLPDLRILA       660
     GIAEELSALG AGRELGFRTV EEARAQMEEM GPWDGQRAAL DTVSAPTAPV GEGLALATWK       720
     LLIDNGVMQD GDKAYRATGR KPVARLGRAT YDAVGPTVTL TGDRGSVTLP AEPADLDDGV       780
     VWVPANSFGN GVLADLASPG SRVTVAKGAD A                                      811
//

If you have problems or comments...

PBIL Back to PBIL home page