(data stored in ACNUC1104 zone)

EMBL: CP000509.PE519

CP000509.PE519       Location/Qualifiers
FT   CDS             558711..560060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0527"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: rha:RHA1_ro05916 probable NADH dehydrogenase
FT                   subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80069"
FT                   /db_xref="GOA:A1SE34"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE34"
FT                   /protein_id="ABL80069.1"
FT                   /translation="MNTLTAPLPMATDALSQFGHDAWWVIGLKAVLILVVLLLLTLFNI
FT                   WFERRVVGRMQHRPGPNVNGPFGLLQSLADALKLIFKEGIIPKAADKAVYLIAPVIAVI
FT                   PSFITFSVIPFGPEVTIPFTDTRTPLQLTDMPVAVLFVMAIASIGIYGIVLGGWSSGST
FT                   YSLLGGLRSSAQMISYEVAMGLALVAVFLYAGSMSTSEIVAAQDNLWYGLILVPSFVIY
FT                   LIAMVGETNRAPFDLPEAEGELVGGFHTEYSSMTFALFFLAEYINMATVSAVATTLFLG
FT                   GWHAPFWLDHAWAGANEGYWPLLWFLGKVLFFVFIFIWLRGTLPRLRYDQFMAFGWKRL
FT                   IPVALVWIVAVATIRSISLDGGVDRRYLLIGIGALAVVFLVLFFIGGAAEEQPTTVPEA
FT                   APAGGYPVPPMPAGGPVRGAAVPLTFDRSSPIASSMPQPSAATRSAGEEI"
     MNTLTAPLPM ATDALSQFGH DAWWVIGLKA VLILVVLLLL TLFNIWFERR VVGRMQHRPG        60
     PNVNGPFGLL QSLADALKLI FKEGIIPKAA DKAVYLIAPV IAVIPSFITF SVIPFGPEVT       120
     IPFTDTRTPL QLTDMPVAVL FVMAIASIGI YGIVLGGWSS GSTYSLLGGL RSSAQMISYE       180
     VAMGLALVAV FLYAGSMSTS EIVAAQDNLW YGLILVPSFV IYLIAMVGET NRAPFDLPEA       240
     EGELVGGFHT EYSSMTFALF FLAEYINMAT VSAVATTLFL GGWHAPFWLD HAWAGANEGY       300
     WPLLWFLGKV LFFVFIFIWL RGTLPRLRYD QFMAFGWKRL IPVALVWIVA VATIRSISLD       360
     GGVDRRYLLI GIGALAVVFL VLFFIGGAAE EQPTTVPEAA PAGGYPVPPM PAGGPVRGAA       420
     VPLTFDRSSP IASSMPQPSA ATRSAGEEI                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page