(data stored in SCRATCH zone)

EMBL: CP000509.PE52

CP000509.PE52        Location/Qualifiers
FT   CDS             complement(60327..60929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79602"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR7"
FT                   /protein_id="ABL79602.1"
FT                   /translation="MCGSSNGLPFLRDDVCVSELLTQLWARVRAQLESARSQLTNPDDE
FT                   ALFLYEDLLSHNELGLALDALADVAFEQRAPGEVWQMLGGAIEAMQLEPDDSVHGGAVQ
FT                   KVLEQLAAAHDWRGLQRLLNEWDPIGVRPDLGGPDDEYSCLYVPLVDRLHAEAPVAEIA
FT                   EFLRAEPSDHFGLDPAYSRPEVFAGRLVEWYASGAPA"
     MCGSSNGLPF LRDDVCVSEL LTQLWARVRA QLESARSQLT NPDDEALFLY EDLLSHNELG        60
     LALDALADVA FEQRAPGEVW QMLGGAIEAM QLEPDDSVHG GAVQKVLEQL AAAHDWRGLQ       120
     RLLNEWDPIG VRPDLGGPDD EYSCLYVPLV DRLHAEAPVA EIAEFLRAEP SDHFGLDPAY       180
     SRPEVFAGRL VEWYASGAPA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page