(data stored in ACNUC1104 zone)

EMBL: CP000509.PE520

CP000509.PE520       Location/Qualifiers
FT   CDS             560060..560650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0528"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   KEGG: fra:Francci3_0546 NADH-quinone oxidoreductase, chain
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80070"
FT                   /db_xref="GOA:A1SE35"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE35"
FT                   /protein_id="ABL80070.1"
FT                   /translation="MAGSPEPKSMREQFWDPIAGFGVTFRTMFKKVVTEQYPFDKYPTA
FT                   PRFHGRHQLNRWPDGLEKCVGCELCAWACPADAIYVEGASNSDDPDGGERFSPGERYGR
FT                   VYQINYLRCILCGLCIEACPTRALTMTNEYELADDNRADLIYEKSDLLAPLLPGMEQPP
FT                   HPMRLGDDEGAYYRGEFAAPAPTAPGSSTEAGA"
     MAGSPEPKSM REQFWDPIAG FGVTFRTMFK KVVTEQYPFD KYPTAPRFHG RHQLNRWPDG        60
     LEKCVGCELC AWACPADAIY VEGASNSDDP DGGERFSPGE RYGRVYQINY LRCILCGLCI       120
     EACPTRALTM TNEYELADDN RADLIYEKSD LLAPLLPGME QPPHPMRLGD DEGAYYRGEF       180
     AAPAPTAPGS STEAGA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page