(data stored in ACNUC1104 zone)

EMBL: CP000509.PE522

CP000509.PE522       Location/Qualifiers
FT   CDS             561471..561770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0530"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: rha:RHA1_ro05919 probable NADH dehydrogenase subunit
FT                   K"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80072"
FT                   /db_xref="GOA:A1SE37"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE37"
FT                   /protein_id="ABL80072.1"
FT                   /translation="MNVTAYVVLSGILFTIGCVGVLIRRNAIVVFMCVELMLNASNLAL
FT                   VAFARQHGNLDGQIAAFFVMVVAAAEVVVGLAIIMTIFRTRRSASVDDASLLKY"
     MNVTAYVVLS GILFTIGCVG VLIRRNAIVV FMCVELMLNA SNLALVAFAR QHGNLDGQIA        60
     AFFVMVVAAA EVVVGLAIIM TIFRTRRSAS VDDASLLKY                               99
//

If you have problems or comments...

PBIL Back to PBIL home page